dbACP: A Comprehensive Database of Anti-Cancer Peptides

14 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01311 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Leukaemia Not found
dbacp01312 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Lung cancer Not found
dbacp01313 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Colon cancer Not found
dbacp01314 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found CNS Not found
dbacp01315 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Skin cancer Not found
dbacp01316 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Ovarian cancer Not found
dbacp01317 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Renal cancer Not found
dbacp01318 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Prostate cancer Not found
dbacp01319 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Not specified Not specified Not found Breast cancer Not found
dbacp01338 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Leukaemia LC50 : 10-5 - 10-4 M
dbacp01339 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Lung cancer LC50 : 10-5 - 10-4 M
dbacp01340 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Colon cancer LC50 : 10-5 - 10-4 M
dbacp01341 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Prostate cancer LC50 : 10-5 - 10-4 M
dbacp01342 Aurein-2.5 MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE Green and golden bell frog Membrane disruption Not specified Human tumour cell lines Breast cancer LC50 : 10-5 - 10-4 M