14 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01311 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Leukaemia | Not found |
| dbacp01312 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Lung cancer | Not found |
| dbacp01313 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Colon cancer | Not found |
| dbacp01314 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | CNS | Not found |
| dbacp01315 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Skin cancer | Not found |
| dbacp01316 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Ovarian cancer | Not found |
| dbacp01317 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Renal cancer | Not found |
| dbacp01318 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Prostate cancer | Not found |
| dbacp01319 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Not specified | Not specified | Not found | Breast cancer | Not found |
| dbacp01338 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Leukaemia | LC50 : 10-5 - 10-4 M |
| dbacp01339 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Lung cancer | LC50 : 10-5 - 10-4 M |
| dbacp01340 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Colon cancer | LC50 : 10-5 - 10-4 M |
| dbacp01341 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Prostate cancer | LC50 : 10-5 - 10-4 M |
| dbacp01342 | Aurein-2.5 | MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE | Green and golden bell frog | Membrane disruption | Not specified | Human tumour cell lines | Breast cancer | LC50 : 10-5 - 10-4 M |