dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02625 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified CLL Leukemia IC50 : 1.5 ± 0.6 µM
dbacp02626 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 2.2 ± 1.6 µM