13 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp05103 | PA10 | RQIKIWFQNRRMKWKKGGGGNNETTSIQIAGSLHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05107 | PA15 | RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05111 | PA2 | RQIKIWFQNRRMKWKKGGATRPRVDTQPELCGMHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05115 | PA3 | RQIKIWFQNRRMKWKKGGDCLCISRRARLLRATHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05119 | PA38 | RQIKIWFQNRRMKWKKGGKYNGRFTTHHLLHLLNHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05123 | PA49 | RQIKIWFQNRRMKWKKGGAGVYTFLVGADNRGWEHHHHHH | Synthetic construct | Cell proliferation inhibition; Cell penetration; Apoptosis | Cell viability assay | MDA-MB231 | Breast cancer | MIC : 10 μM |
| dbacp05509 | Phylloseptin-1.1TR (PLS-1.1TR) | FLSLIPKIAGGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 20 μM |
| dbacp05512 | Phylloseptin-1.2TR (PLS-1.2TR) (Phylloseptin-1.3TR) | FLSLIPKIAGGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | Not found |
| dbacp05515 | Phylloseptin-2.1TR (PLS-2.1TR) (Phylloseptin-2.2TR) | FLSLIPHIATGIAALAKHL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 24 μM |
| dbacp05518 | Phylloseptin-3.1TR (PLS-3.1TR) (Phylloseptin-3.3TR) | FFSMIPKIATGIASLVKNL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | LC50 : 18 μmolL−1 |
| dbacp05521 | Phylloseptin-3.2TR (PLS-3.2TR) | FFSMIPKIATGIASLVKDL | Trinidad leaf frog | Cytotoxic | Cell viability assay | MDA‐MB231 | Not found | Not found |
| dbacp05532 | Phylloseptin-PBa1 | FLSLIPHIASGIASLVKNF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.29 µM |
| dbacp05543 | Phylloseptin-PBa2 | FLSLLPHIASGIASLVSKF | Burmeister's leaf frog, Brazil, South America | Disruption of cell membranes | MTT cell viability assay | MB231 | Breast cancer | IC50 : approx. 0.50 µM |