dbACP: A Comprehensive Database of Anti-Cancer Peptides

23 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01156 Ant-p53pep GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG Not found Apoptosis inducing Annexin V-FITC Binding assay MDA-MB-468 Breast cancer IC50 : 30 µM
dbacp01300 Aurein-1.3 GLFDIIKKIAESF Southern bell frog Cell membrane disintegration One-dose and five-dose assay MDA-MB-468 Breast cancer IC50 : 5 μM
dbacp02597 Cyclic [W(RW)4 ]-Dox WRWRWRWRW Not found Inhibition of the cell proliferation MTT/MTS assay MDA-MB-468 Breast cancer 60-79% inhibition of cell proliferation at 1 µM
dbacp04106 linear (RW)4-Dox RWRWRWRW Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP Inhibition of the cell proliferation MTT/MTS assay MDA-MB-468 Breast cancer 60-74% anti-proliferative activity at 1 µM
dbacp04921 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 30% Cytotoxic at 5 µM
dbacp04922 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 40-50% Cytotoxic at 10 µM
dbacp04923 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 60-70% Cytotoxic at 25 µM
dbacp04924 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04944 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 30% Cytotoxic at 5 µM
dbacp04945 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 40-50% Cytotoxic at 10 µM
dbacp04946 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 60-70% Cytotoxic at 25 µM
dbacp04947 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04966 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 10% Cytotoxic at 5 µM
dbacp04967 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 50% Cytotoxic at 10 µM
dbacp04968 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 80% Cytotoxic at 25 µM
dbacp04969 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 80-90% Cytotoxic at 50 µM
dbacp04976 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 80% Cytotoxic at 25 µM
dbacp04988 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer ~5% Cytotoxic at 5 µM
dbacp04989 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer ~5% Cytotoxic at 10 µM
dbacp04990 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 5% Cytotoxic at 25 µM
dbacp04991 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay MDA-MB-468 Breast cancer 10-15% Cytotoxic at 50 µM
dbacp05078 p53-C terminal peptide GSRAHSSHLKSKKGQSTSRHKK Not found Inducing apoptosis Annexin V-FITC Binding assay MDA-MB-468 Breast cancer Not found
dbacp06868 LfcinB(21-25)Pal RWQWRWQWR LfcinB Apoptosis inducing MTT assay MDA-MB-468 Breast Cancer IC50 = 72 µM