23 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01156 | Ant-p53pep | GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG | Not found | Apoptosis inducing | Annexin V-FITC Binding assay | MDA-MB-468 | Breast cancer | IC50 : 30 µM |
| dbacp01300 | Aurein-1.3 | GLFDIIKKIAESF | Southern bell frog | Cell membrane disintegration | One-dose and five-dose assay | MDA-MB-468 | Breast cancer | IC50 : 5 μM |
| dbacp02597 | Cyclic [W(RW)4 ]-Dox | WRWRWRWRW | Not found | Inhibition of the cell proliferation | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-79% inhibition of cell proliferation at 1 µM |
| dbacp04106 | linear (RW)4-Dox | RWRWRWRW | Doxorubicin (Dox) is a well-known anthracycline which has been conjugated to a CPP | Inhibition of the cell proliferation | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-74% anti-proliferative activity at 1 µM |
| dbacp04921 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04922 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04923 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-70% Cytotoxic at 25 µM |
| dbacp04924 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04944 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04945 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 40-50% Cytotoxic at 10 µM |
| dbacp04946 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 60-70% Cytotoxic at 25 µM |
| dbacp04947 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04966 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 10% Cytotoxic at 5 µM |
| dbacp04967 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04968 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04969 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80-90% Cytotoxic at 50 µM |
| dbacp04976 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 80% Cytotoxic at 25 µM |
| dbacp04988 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | ~5% Cytotoxic at 5 µM |
| dbacp04989 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | ~5% Cytotoxic at 10 µM |
| dbacp04990 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 5% Cytotoxic at 25 µM |
| dbacp04991 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | MDA-MB-468 | Breast cancer | 10-15% Cytotoxic at 50 µM |
| dbacp05078 | p53-C terminal peptide | GSRAHSSHLKSKKGQSTSRHKK | Not found | Inducing apoptosis | Annexin V-FITC Binding assay | MDA-MB-468 | Breast cancer | Not found |
| dbacp06868 | LfcinB(21-25)Pal | RWQWRWQWR | LfcinB | Apoptosis inducing | MTT assay | MDA-MB-468 | Breast Cancer | IC50 = 72 µM |