dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04636 Medusin-C1 MDFLKKSLFLVVFLGLVSLSVCEEEKRESEEEKNEQEEDDREERSEEKRLLGMIPLAISAISALSKLG Red-eyed tree frog Not specified Not specified Not found Not found Not found
dbacp04637 Medusin-C1 (MDS-C1) (Medusin-AC) (Phyllin-AC) MDFLKKSLFLVVFLGLVSLSVCEEEKRESEEEKNEQEEDDREERSEEKRLLGMIPLAISAISALSKLG Red-eyed tree frog Not specified Not specified Not found Not found Not found