4 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02651 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MDA-MB-435S | Lung cancer | MIC : 10−9 to 10−4 M |
| dbacp02652 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | H157 | Glioma | MIC : 10−9 to 10−4 M |
| dbacp02653 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | PC-3 | Prostate cancer | MIC : 10−9 to 10−4 M |
| dbacp02654 | Dermaseptin PS4 | MDILKKSIFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEEKRALWKTLLKHVGKAAGKAALNAVTDMVNQGEQ | Sauvage's leaf frog | Membrane disruption | Lactate dehydrogenase (LDH) cytotoxicity assay, MTT assay | MCF-7 | Breast cancer | MIC : 10−9 to 10−4 M |