30 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03485 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Brain tumor | IC50 : 8.64μM |
| dbacp03486 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Breast cancer | IC50 : 8.64μM |
| dbacp03487 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Pancreatic cancer | IC50 : 8.64μM |
| dbacp03488 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Lung cancer | IC50 : 8.64μM |
| dbacp03489 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | MCF-7 | Prostate cancer | IC50 : 8.64μM |
| dbacp03490 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Brain tumor | IC50 : 18.51μM |
| dbacp03491 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Breast cancer | IC50 : 18.51μM |
| dbacp03492 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Pancreatic cancer | IC50 : 18.51μM |
| dbacp03493 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Lung cancer | IC50 : 18.51μM |
| dbacp03494 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | U251MG | Prostate cancer | IC50 : 18.51μM |
| dbacp03495 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Brain tumor | IC50 : 9.88μM |
| dbacp03496 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Breast cancer | IC50 : 9.88μM |
| dbacp03497 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Pancreatic cancer | IC50 : 9.88μM |
| dbacp03498 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Lung cancer | IC50 : 9.88μM |
| dbacp03499 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | H157 | Prostate cancer | IC50 : 9.88μM |
| dbacp03500 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Brain tumor | IC50 : 9.97μM |
| dbacp03501 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Breast cancer | IC50 : 9.97μM |
| dbacp03502 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Pancreatic cancer | IC50 : 9.97μM |
| dbacp03503 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Lung cancer | IC50 : 9.97μM |
| dbacp03504 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PC-3 | Prostate cancer | IC50 : 9.97μM |
| dbacp03505 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Brain tumor | IC50 : 11.17μM |
| dbacp03506 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Breast cancer | IC50 : 11.17μM |
| dbacp03507 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Pancreatic cancer | IC50 : 11.17μM |
| dbacp03508 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Lung cancer | IC50 : 11.17μM |
| dbacp03509 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | PANC-1 | Prostate cancer | IC50 : 11.17μM |
| dbacp03510 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 48.80μM |
| dbacp03511 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 48.80μM |
| dbacp03512 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 48.80μM |
| dbacp03513 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 48.80μM |
| dbacp03514 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 48.80μM |