49 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01173 | Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Apoptosis inducing | Not specified | MEC-1 | Leukemia | IC50 : 2.5 ± 0.1 µM |
| dbacp01435 | B1AW | FLPLLAGLAANFLPQIICKIARKC | Wuyi torrent frog | Cell membrane penetration | MTT assay | HMEC-1 | Glioblastoma cancer | IC50 : 32.96 μM |
| dbacp02619 | D-Antp-LP4 | RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | Not found | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.6 ± 0.3 µM |
| dbacp02624 | D-MinAntp-LP4 | KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | Not found | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.4 ± 0.1 µM |
| dbacp02626 | D-N-Ter-Antp | MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 2.2 ± 1.6 µM |
| dbacp02718 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 51.04 μM |
| dbacp02719 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 51.04 μM |
| dbacp02720 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 51.04 μM |
| dbacp02721 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 51.04 μM |
| dbacp02722 | Dermaseptin-PH (DRS-PH) | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 51.04 μM |
| dbacp02785 | dLL-37(17-32)c | FKRIVQRIKDFLRNLV | LL-37, a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp03510 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Brain tumor | IC50 : 48.80μM |
| dbacp03511 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Breast cancer | IC50 : 48.80μM |
| dbacp03512 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Pancreatic cancer | IC50 : 48.80μM |
| dbacp03513 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Lung cancer | IC50 : 48.80μM |
| dbacp03514 | K8, 23-DPT9 | MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay | HMEC-1 | Prostate cancer | IC50 : 48.80μM |
| dbacp04157 | LL-37(1-12) | LLGDFFRKSKEK | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp04160 | LL-37(1-4,17-27) | LLGDFKRIVQRIKDF | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | Not found |
| dbacp04163 | LL-37(13-37) | IGKEFKRIVQRIKDFLRNLVPRTES | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 38 µM |
| dbacp04166 | LL-37(13-37)(C-terminal fragment of LL-37; Human, mammals, animals) | IGKEFKRIVQRIKDFLRNLVPRTES | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 38 ± 3 μM |
| dbacp04169 | LL-37(17-29) | FKRIVQRIKDFLR | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 55 µM |
| dbacp04173 | LL-37(17-29)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 55 ± 2 μM |
| dbacp04176 | LL-37(17-32)(C-terminal fragment of LL-37; Human, mammals, animals) | FKRIVQRIKDFLRNLV | Human | Not specified | MTT assay | HBMEC | Prostate cancer | LC50 : 25 ± 1 μM |
| dbacp04179 | LL-37(17-32)b | FKRIVQRIKDFLRNLV | LL-37,a series of peptide fragments | Cell membrane disintegration | MTT/MTS assay | HBMEC | Prostate cancer | LC50 : 25 µM |
| dbacp04288 | LP-4 peptide | SWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | Not found |
| dbacp04583 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04589 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : < 4 μM |
| dbacp04684 | Min-Antp-LP4 | KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.7 ± 0.4 µM |
| dbacp04792 | N-Ter-Antp | N-Ter-RQIKIWFQNRRMKWKK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 4.2 ± 0.2 µM |
| dbacp05816 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 588.20 µM |
| dbacp05817 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 588.20 µM |
| dbacp05818 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 588.20 µM |
| dbacp05819 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 588.20 µM |
| dbacp05897 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 79.50 µM |
| dbacp05898 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 79.50 µM |
| dbacp05899 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 79.50 µM |
| dbacp05900 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp05911 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | HMEC-1 | Glioma | IC50 : 79.50 µM |
| dbacp05951 | RGD-La | RGDLLRHVVKILEKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | MEC | Breast cancer | 19.76 Inhibition ratio at 50 µg/ml |
| dbacp05960 | RGD-Las | RGDLLRHVVKILSKYL | Arg-Gly-Asp(RGD) tripeptide ana temporins | Cell membrane disintegration | MTT/MTS assay | MEC | Breast cancer | 29.33 Inhibition ratio at 50 µg/ml |
| dbacp06004 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Lung cancer | IC50 : 1185.00 µM |
| dbacp06005 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Prostate cancer | IC50 : 1185.00 µM |
| dbacp06006 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Breast cancer | IC50 : 1185.00 µM |
| dbacp06007 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | HMEC-1 | Glioma | IC50 : 1185.00 µM |
| dbacp06265 | Temporin-Las | LLRHVVKILEKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | MEC | Breast cancer | 24.15 inhibition ratio at 50 µg/ml |
| dbacp06266 | Temporin-Las | LLRHVVKILSKYL | Temporins family | Cell membrane disintegration | MTT/MTS assay | MEC | Breast cancer | 27.99 inhibition ratio at 50 µg/ml |
| dbacp06302 | Tf-D-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 1.8 ± 0.2 µM |
| dbacp06304 | Tf-LP4 | HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK | VDAC1(voltage-dependent anion channel1) | Inducing apoptosis | Not specified | MEC-1 | Leukemia | IC50 : 3.6 ± 0.2 µM |
| dbacp08076 | PvD1 | KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC | Phaseolus vulgaris | Disrupts tumor cells | MTT assay | HBMEC | Brain Cancer | Not Available |