dbACP: A Comprehensive Database of Anti-Cancer Peptides

35 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01173 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified MEC-1 Leukemia IC50 : 2.5 ± 0.1 µM
dbacp01435 B1AW FLPLLAGLAANFLPQIICKIARKC Wuyi torrent frog Cell membrane penetration MTT assay HMEC-1 Glioblastoma cancer IC50 : 32.96 μM
dbacp02619 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.6 ± 0.3 µM
dbacp02624 D-MinAntp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.4 ± 0.1 µM
dbacp02626 D-N-Ter-Antp MAVPPTYADLGKSARDVFTKGYGFGLRQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 2.2 ± 1.6 µM
dbacp02718 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 51.04 μM
dbacp02719 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 51.04 μM
dbacp02720 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 51.04 μM
dbacp02721 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 51.04 μM
dbacp02722 Dermaseptin-PH (DRS-PH) MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 51.04 μM
dbacp03510 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Brain tumor IC50 : 48.80μM
dbacp03511 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Breast cancer IC50 : 48.80μM
dbacp03512 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Pancreatic cancer IC50 : 48.80μM
dbacp03513 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Lung cancer IC50 : 48.80μM
dbacp03514 K8, 23-DPT9 MDILKKSKFLILFLGVVSLSICKEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay HMEC-1 Prostate cancer IC50 : 48.80μM
dbacp04288 LP-4 peptide SWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia Not found
dbacp04583 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma MIC : 6.26 - 36.65 μM
dbacp04589 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : < 4 μM
dbacp04684 Min-Antp-LP4 KRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.7 ± 0.4 µM
dbacp04792 N-Ter-Antp N-Ter-RQIKIWFQNRRMKWKK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 4.2 ± 0.2 µM
dbacp05816 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay HMEC-1 Lung cancer IC50 : 588.20 µM
dbacp05817 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay HMEC-1 Prostate cancer IC50 : 588.20 µM
dbacp05818 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay HMEC-1 Breast cancer IC50 : 588.20 µM
dbacp05819 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 588.20 µM
dbacp05897 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Lung cancer IC50 : 79.50 µM
dbacp05898 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Prostate cancer IC50 : 79.50 µM
dbacp05899 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Breast cancer IC50 : 79.50 µM
dbacp05900 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 79.50 µM
dbacp05911 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay HMEC-1 Glioma IC50 : 79.50 µM
dbacp06004 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Lung cancer IC50 : 1185.00 µM
dbacp06005 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Prostate cancer IC50 : 1185.00 µM
dbacp06006 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Breast cancer IC50 : 1185.00 µM
dbacp06007 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay HMEC-1 Glioma IC50 : 1185.00 µM
dbacp06302 Tf-D-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.8 ± 0.2 µM
dbacp06304 Tf-LP4 HAIYPRHSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 3.6 ± 0.2 µM