dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05131 Palustrin-Ca MFTLKKSLLLLFFLGTISLSLCEQERDADGDEGEVEEVKRGFLDIIKDTGKEFAVKILNNLKCKLAGGCPP American bullfrog Not specified Not specified Not found Not found Not found
dbacp05132 Palustrin-Ca MFTLKKSLLLLFFLGTISLSLCEQERDADGDEGEVEEVKRGFLDIIKDTGKEFAVKILNNLKCKLAGGCPP American bullfrog Membrane disruption Not specified Not found Not found Not found