6 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02640 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-484 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02641 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-601 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02642 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-638 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp02643 | Defensin coprisin | MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN | Dung beetle | Induces apoptosis and necrosis | Radial diffusion assay, MIC assay | SNU-668 | Gastric cancer | MIC : ≤ 50 μM |
| dbacp04953 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | PWinter flounder | Rupture cell membranes | MIC assay | Not found | Not found | MIC : 1 - 8µg/ml |
| dbacp06351 | Tritrpticin | VRRFPWWWPFLRR | Pig | Membrane disruption | MIC assay | Not found | Not found | MIC : 2 mM |