dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06041 Sec-independent protein translocase protein TatA MLRNGLEPWHLLIVAIVFLVLFGSKKLPDMARSLGKSARILKSEAAAMKSDGGPAAERASGGGPAAPAPAATQPSGSAPAGDRDRARDR Streptomyces sp. VN1 Not specified Cytotoxicity assay AGS Gastric cancer IC50 : 40.5 µM
dbacp06042 Sec-independent protein translocase protein TatA MLRNGLEPWHLLIVAIVFLVLFGSKKLPDMARSLGKSARILKSEAAAMKSDGGPAAERASGGGPAAPAPAATQPSGSAPAGDRDRARDR Streptomyces sp. VN1 Not specified Cytotoxicity assay HCT116 Colon cancer IC50 : 123.7 µM
dbacp06043 Sec-independent protein translocase protein TatA MLRNGLEPWHLLIVAIVFLVLFGSKKLPDMARSLGKSARILKSEAAAMKSDGGPAAERASGGGPAAPAPAATQPSGSAPAGDRDRARDR Streptomyces sp. VN1 Not specified Cytotoxicity assay A375SM Melanoma IC50 : 84.67 µM
dbacp06044 Sec-independent protein translocase protein TatA MLRNGLEPWHLLIVAIVFLVLFGSKKLPDMARSLGKSARILKSEAAAMKSDGGPAAERASGGGPAAPAPAATQPSGSAPAGDRDRARDR Streptomyces sp. VN1 Not specified Cytotoxicity assay U87MG Lung cancer IC50 : 50 µM
dbacp06045 Sec-independent protein translocase protein TatA MLRNGLEPWHLLIVAIVFLVLFGSKKLPDMARSLGKSARILKSEAAAMKSDGGPAAERASGGGPAAPAPAATQPSGSAPAGDRDRARDR Streptomyces sp. VN1 Not specified Cytotoxicity assay A549 Glioblastoma IC50 : 58.64 µM