dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06075 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay K-562 Leukemia cancer IC50 : 28.7 µM
dbacp06076 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay BTS-30 Breast cancer IC50 : 56 µM
dbacp06077 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay HRT-18 Colon cancer IC50 : 49.3 µM
dbacp06078 Shiva-1 MPRWRLFRRIDRVGKQIKQGILRAGPAIALVGDARAVG African clawed frog Pore formation at the cytoplasmic membrane MTT/MTS assay DLD-1 Colon cancer IC50 : >100 µM