17 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03154 | GPR15LG | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Inducing G1 arrest | Not specified | Not found | Colon cancer | Not found |
| dbacp05657 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | Raji | Colorectal cancer | IC50 : 6 μM |
| dbacp05658 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | Jurcat | Colorectal cancer | Not found |
| dbacp05659 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | K562 | Colorectal cancer | Not found |
| dbacp05660 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | U937 | Colorectal cancer | Not found |
| dbacp05661 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | A549 | Colorectal cancer | Not found |
| dbacp05662 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HT-29 | Colorectal cancer | Not found |
| dbacp05663 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | LoVo | Colorectal cancer | Not found |
| dbacp05664 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | U87 | Colorectal cancer | Not found |
| dbacp05665 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | MCF-7 | Colorectal cancer | Not found |
| dbacp05666 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | SKOV3 | Colorectal cancer | Not found |
| dbacp05667 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | PC-3 | Colorectal cancer | Not found |
| dbacp05668 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HepG2 | Colorectal cancer | Not found |
| dbacp05669 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | L02 | Colorectal cancer | Not found |
| dbacp05670 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HaCaT | Colorectal cancer | Not found |
| dbacp05671 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HEK293 | Colorectal cancer | Not found |
| dbacp05672 | Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | Human | Cytotoxic effects | SDS-PAGE assay | HUVEC | Colorectal cancer | Not found |