dbACP: A Comprehensive Database of Anti-Cancer Peptides

11 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02678 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MCF-7 Not specified IC50 : 0.69 μM
dbacp02679 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay H157 Not specified IC50 : 2.01 μM
dbacp02680 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay U251MG Not specified IC50 : 2.36 μM
dbacp02681 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay MDA-MB-435S Not specified IC50 : 9.94 μM
dbacp02682 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLVQ Northern orange-legged leaf frog Cell membrane permeabilization Bioactivity assessment assay, MTT cell proliferation assay PC-3 Not specified IC50 : 11.8 μM
dbacp02683 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MCF-7 Lung cancer IC50 : 0.69 μM
dbacp02684 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay H157 Glioma IC50 : 2.01 μM
dbacp02685 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay U251MG Prostate cancer IC50 : 2.36 μM
dbacp02686 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay MDA-MB-435S Breast cancer IC50 : 9.94 μM
dbacp02687 Dermaseptin-PH ALWKEVLKNAGKAALNEINNLV Orange-legged leaf frog, Northern orange-legged leaf frog, South America Cell membrane permeabilization MTT cell proliferation assay PC-3 Human prostate carcinoma IC50 : 11.8 μM
dbacp02723 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Rock Kribensis Cichlid Disrupting cell membranes; Apoptosis Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay U251MG Human glioblastoma MIC : 10−5 M and above