11 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02678 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MCF-7 | Not specified | IC50 : 0.69 μM |
| dbacp02679 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | H157 | Not specified | IC50 : 2.01 μM |
| dbacp02680 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | U251MG | Not specified | IC50 : 2.36 μM |
| dbacp02681 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | MDA-MB-435S | Not specified | IC50 : 9.94 μM |
| dbacp02682 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLVQ | Northern orange-legged leaf frog | Cell membrane permeabilization | Bioactivity assessment assay, MTT cell proliferation assay | PC-3 | Not specified | IC50 : 11.8 μM |
| dbacp02683 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MCF-7 | Lung cancer | IC50 : 0.69 μM |
| dbacp02684 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | H157 | Glioma | IC50 : 2.01 μM |
| dbacp02685 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | U251MG | Prostate cancer | IC50 : 2.36 μM |
| dbacp02686 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | MDA-MB-435S | Breast cancer | IC50 : 9.94 μM |
| dbacp02687 | Dermaseptin-PH | ALWKEVLKNAGKAALNEINNLV | Orange-legged leaf frog, Northern orange-legged leaf frog, South America | Cell membrane permeabilization | MTT cell proliferation assay | PC-3 | Human prostate carcinoma | IC50 : 11.8 μM |
| dbacp02723 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Rock Kribensis Cichlid | Disrupting cell membranes; Apoptosis | Lactate dehydrogenase (LDH) assay, MTT cell proliferation assay | U251MG | Human glioblastoma | MIC : 10−5 M and above |