dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp08329 Sample Peptide 1 from EP3604345B1 MQIPQAPWPVVWAVLQLGWRKKRTLRKNDRKKR Synthetic Not Available CCK-8 / WST-8 NCI-H446 Lung Cancer Cell Viability = 0.5% at 25 μM
dbacp08337 Sample Peptide 3 from EP3604345B1 MRIFAVFIFMTYWHLLNAKKRTLRKNDRKKR Synthetic Not Available CCK-8 / WST-8 NCI-H446 Lung Cancer Cell Viability = 56.7% at 25 μM