1 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp03334 | Human granulysin | GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLR | NK cells; T lymphocytes; Human | Through the granule-exocytosis pathway may release one or more effector molecules with the capacity to directly kill the intracellular microbial pathogen | Not specified | Not found | Not found | Not found |