dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03334 Human granulysin GRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLR NK cells; T lymphocytes; Human Through the granule-exocytosis pathway may release one or more effector molecules with the capacity to directly kill the intracellular microbial pathogen Not specified Not found Not found Not found