13 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02668 | Dermaseptin-PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | U251MG | Human neuronal glioblastoma | IC50 : 15.08 μM |
| dbacp02671 | Dermaseptin-PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Skin Secretion, Mexican leaf frog, Mexico, North America | Destroy plasma membrane | MTT assay | U251MG | Human neuronal glioblastoma | IC50 : 13.43 μM |
| dbacp02672 | Dermaseptin-PD1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02675 | Dermaseptin-PD2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | Mexican leaf frog | Destroy plasma membrane | MTT assay | H157 | Neuronal glioblastoma | IC50 : 6.43 μM |
| dbacp02688 | Dermaseptin-PH | MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ | Northern orange-legged leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 17.44 - 49.51 μM |
| dbacp02731 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Brownbelly leaf frog | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 8.64 - 18.51 μM |
| dbacp02736 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America | Disruption of cell membranes | MTT assay, Lactate dehydrogenase (LDH) assay | U251MG | Neuronal glioblastoma | IC50 : 8.64 - 18.51 μM |
| dbacp06271 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06272 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Human neuronal glioblastoma | TI : 10μM |
| dbacp06273 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | PC-3 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06274 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | MDA-MB-435s | Human neuronal glioblastoma | TI : 10μM |
| dbacp06275 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | NCI-H157 | Human neuronal glioblastoma | TI : 10μM |
| dbacp06284 | Temporin-PE | FLPIVAKLLSGLL | Skin secretions, Common water frog or green frog, Europe | Destabilization of membranes | MTT assay | U251MG | Human neuronal glioblastoma | TI : approx. 10μM |