dbACP: A Comprehensive Database of Anti-Cancer Peptides

13 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02668 Dermaseptin-PD-1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay U251MG Human neuronal glioblastoma IC50 : 15.08 μM
dbacp02671 Dermaseptin-PD-2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Skin Secretion, Mexican leaf frog, Mexico, North America Destroy plasma membrane MTT assay U251MG Human neuronal glioblastoma IC50 : 13.43 μM
dbacp02672 Dermaseptin-PD1 GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ Mexican leaf frog Destroy plasma membrane MTT assay H157 Neuronal glioblastoma IC50 : 6.43 μM
dbacp02675 Dermaseptin-PD2 GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI Mexican leaf frog Destroy plasma membrane MTT assay H157 Neuronal glioblastoma IC50 : 6.43 μM
dbacp02688 Dermaseptin-PH MDILKKSLFLILFLGVVSLSICEEEKRENEEEMEQDDEQSEMKRALWKEVLKNAGKAALNEINNLVQGGQ Northern orange-legged leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 17.44 - 49.51 μM
dbacp02731 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Brownbelly leaf frog Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp02736 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Skin secretion, Brownbelly leaf frog, Purchased in Peru, South America Disruption of cell membranes MTT assay, Lactate dehydrogenase (LDH) assay U251MG Neuronal glioblastoma IC50 : 8.64 - 18.51 μM
dbacp06271 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Human neuronal glioblastoma TI : 10μM
dbacp06272 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Human neuronal glioblastoma TI : 10μM
dbacp06273 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay PC-3 Human neuronal glioblastoma TI : 10μM
dbacp06274 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay MDA-MB-435s Human neuronal glioblastoma TI : 10μM
dbacp06275 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay NCI-H157 Human neuronal glioblastoma TI : 10μM
dbacp06284 Temporin-PE FLPIVAKLLSGLL Skin secretions, Common water frog or green frog, Europe Destabilization of membranes MTT assay U251MG Human neuronal glioblastoma TI : approx. 10μM