dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03336 Human neutrophil peptide-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03337 Human neutrophil peptide-2 CYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found
dbacp03338 Human neutrophil peptide-3 DCYCRIPACIAGERRYGTCIYQGRLWAFCC Neutrophils; natural killer cells, monocytes; airway, saliva; Human Cell membrane disintegration Not specified Not found Fibrosarcoma Not found