dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02034 Buforin IIb RAGLQFPVGRLLRRLLRRLLR Histone H2A Inducing mitochondria-dependent apoptosis MTT/MTS assay OVRCAR-3 Ovarian cancer IC50 : 15.2 µg/ml
dbacp02092 Buforin Iib RAGLQFPVGRLLRRLLRRLLR Not found Inducing apoptosis MTT/MTS assay OVRCAR-3 Not specified IC50 : 15.2 µg/ml
dbacp04150 LL 37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Also known human cathelicidin Plasma membrane perturbations MTT/MTS assay OVRCAR-3 Ovarian cancer LC50 : 24 at 100 µM
dbacp05486 Pexiganan GIGKFLKKAKKFGKAFVKILKK Analog of African clawed frog Plasma membrane perturbations MTT/MTS assay OVRCAR-3 Ovarian cancer LC50 : 13 at 100 µM