2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02724 | Dermaseptin-PS1 | ALWKTMLKKLGTVALHAGKAALGAVADTISQ | Skin, the waxy monkey tree frog, South America | Penetrating cell membrane | Not specified | Not found | Not found | Not found |
| dbacp06530 | VLL-28 | VLLVTLTRLHQRGVIYRKWRHFSGRKYR | Thermophilic archaeon | Penetrating cell membrane | Not specified | Not found | Not found | Not found |