14 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02430 | ChaC1 | GDACGETCFTGICFTAGCSCNPWPTCTRN | Hybrid peptide of melittin and protamine | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02432 | ChaC10 | GEYCGESCYLIPCFTPGCYCVSRQCVNKN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02434 | ChaC11 | IPCGESCVWIPCISGMFGCSCKDKVCYS | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02435 | ChaC11 | IPCGESCVWIPCISGMFGCSCKDKVCYS | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02436 | ChaC2 | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02438 | ChaC4 | GASCGETCFTGICFTAGCSCNPWPTCTRN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02440 | ChaC7 | IPCGESCVWIPCITAIAGCSCKNKVCYT | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02441 | ChaC7 | IPCGESCVWIPCITAIAGCSCKNKVCYT | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02442 | ChaC8 | AIPCGESCVWIPCISTVIGCSCSNKVCYR | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02460 | Chassatide C10 | GEYCGESCYLIPCFTPGCYCVSRQCVNKN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02461 | Chassatide C2 | GIPCAESCVWIPPCTITALMGCSCKNNVCYNN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02462 | Chassatide C4 | GASCGETCFTGICFTAGCSCNPWPTCTRN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02463 | Chassatide C4 | GDACGETCFTGICFTAGCSCNPWPTCTRN | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |
| dbacp02464 | Chassatide C8 | AIPCGESCVWIPCISTVIGCSCSNKVCYR | Beras-beras | Permeabilization of the lipid membrane of the target cells | Not specified | Not found | Not found | Not found |