dbACP: A Comprehensive Database of Anti-Cancer Peptides

14 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02430 ChaC1 GDACGETCFTGICFTAGCSCNPWPTCTRN Hybrid peptide of melittin and protamine Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02432 ChaC10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02434 ChaC11 IPCGESCVWIPCISGMFGCSCKDKVCYS Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02435 ChaC11 IPCGESCVWIPCISGMFGCSCKDKVCYS Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02436 ChaC2 GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02438 ChaC4 GASCGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02440 ChaC7 IPCGESCVWIPCITAIAGCSCKNKVCYT Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02441 ChaC7 IPCGESCVWIPCITAIAGCSCKNKVCYT Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02442 ChaC8 AIPCGESCVWIPCISTVIGCSCSNKVCYR Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02460 Chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02461 Chassatide C2 GIPCAESCVWIPPCTITALMGCSCKNNVCYNN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02462 Chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02463 Chassatide C4 GDACGETCFTGICFTAGCSCNPWPTCTRN Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found
dbacp02464 Chassatide C8 AIPCGESCVWIPCISTVIGCSCSNKVCYR Beras-beras Permeabilization of the lipid membrane of the target cells Not specified Not found Not found Not found