dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01840 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay DLBCL Leukemia Not found
dbacp01841 BIRD-2 (Bcl-2 IP3R disrupter 2) RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Not found Inducing apoptosis MTT assay CLL Leukemia Not found