dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00311 (Bl- LAAO) L-amino acid oxidases (L-AAO) ADDRNPLEECFRETDYEEFLEIAKNGLSTT Venom base Apoptosis inducing MTT assay RKO Colorectal cancer Not found
dbacp01443 Baceridin cyclo(L-Trp-D-Ala-D-allo-Ile-L-Val-D-Leu-L-Leu-) Synthetic construct Apoptosis inducing MTT assay RKO Not specified Not found
dbacp01446 Baceridin WAIVLL Plant-associated rod-shaped, Gram-positive bacteria Apoptosis inducing MTT assay RKO Not specified Not found
dbacp07548 Sur-X YGRKKRRQRRRKDHRISTFKNWPFLEGCACTPERM Synthetic Disrupts XIAP-survivin, induces apoptosis/necroptosis MTT assay RKO Colon Cancer 25% cell viability at at 20 μM