dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05107 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MDA-MB231 Breast cancer MIC : 10 μM
dbacp05108 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay HCC1806 Breast cancer MIC : 10 μM
dbacp05109 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay 184B5 Breast cancer MIC : 10 μM
dbacp05110 PA15 RQIKIWFQNRRMKWKKGGSLSAACHEQWSLGAQHHHHHH Synthetic construct Cell proliferation inhibition; Cell penetration; Apoptosis Cell viability assay MCF10A Breast cancer MIC : 10 μM