3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01150 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | 1483 | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 32.9 µM |
| dbacp01151 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22A | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 82 µM |
| dbacp01152 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : > 100 µM |