3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01147 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | 1483 | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 24.8 µM |
| dbacp01148 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | UM-22A | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 18.3 µM |
| dbacp01149 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 40.2 µM |