dbACP: A Comprehensive Database of Anti-Cancer Peptides

4 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01172 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified CLL Leukemia IC50 : 0.7 ± 0.1 µM
dbacp01173 Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK VDAC1(voltage-dependent anion channel1) Apoptosis inducing Not specified MEC-1 Leukemia IC50 : 2.5 ± 0.1 µM
dbacp02618 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified CLL Leukemia IC50 : 0.7 ± 0.4 µM
dbacp02619 D-Antp-LP4 RQIKIWFQNRRMKWKKSWTWEKKLETAVNLAWTAGNSNKWTWK Not found Inducing apoptosis Not specified MEC-1 Leukemia IC50 : 1.6 ± 0.3 µM