2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp06924 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | DU-145 | Liver Cancer | Graph figure 1-B |
| dbacp06925 | #2(D33-N52) | RRRRRRRRGGDRDYKKFWAGLQGLTIYFYN | STAP-2 PH domain–derived peptide | Inhibition of cell signalling | CellTiter-Glo assay | MCF-7 | Breast Cancer | Graph figure 1-B |