dbACP: A Comprehensive Database of Anti-Cancer Peptides

10 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02327 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 231.26 µg/ml
dbacp02331 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 96.22 µg/ml
dbacp02335 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Silkmoth Membrane disruption LDH leakage assay RT4 Bladder cancer IC50 : 289.3 µg/ml
dbacp02346 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption WST-1 assay RT4 Bladder cancer IC50 : 184.81 µg/ml
dbacp02350 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption Cell viability assay RT4 Bladder cancer IC50 : 92.9 µg/ml
dbacp02354 Cecropin B KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL Chinese oak silk moth Membrane disruption LDH leakage assay RT4 Bladder cancer IC50 : 240.4 µg/ml
dbacp04477 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation LDH leakage assay RT4(G1) Bladder cancer IC50 : 32.3 µM
dbacp04480 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation WST-1 assay RT4(G1) Bladder cancer IC50 : 484 µM
dbacp04483 Magainin 2 GIGKFLHSAKKFGKAFVGEIMNS African clawed frog Membrane perforation Cell viability assay RT4(G1) Bladder cancer IC50 : 135.3 µM
dbacp05588 Polyarginine (R11) RRRRRRRRRRR Not found Not specified Not specified T24, 5637, RT4 Bladder cancer Not found