2 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp02375 | CecropinXJ | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK | Larvae, Domestic silk moth | Disruption of cell membrane | Not specified | Not found | Not found | Not found |
| dbacp02376 | CecropinXJ (Insects, arthropods, invertebrates, animals) | RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK | Domestic silk moth | Not specified | Not specified | Not found | Not found | Not found |