dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp00954 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay K562 cells Leukemia IC50 : 349.5 μM
dbacp00955 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay U937 cells Leukemia IC50 : 303.2 μM
dbacp00956 ABP-dHC-Cecropin A-K RWKIFKKIERVGQNVRDGIIKAGKAIQVLGTAKALGK Synthetic construct Apoptosis inducing MTT assay THP-1 cells Leukemia IC50 : 228.5 μM