dbACP: A Comprehensive Database of Anti-Cancer Peptides

5 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02639 Defensin (Galiomicin) MAKNFQSVLLLVCLSFLVIVSSPQNAVQADTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE Greater wax moth Membrane disintegration due to pore-forming or carpet-like mechanisms of action Radial diffusion assay Not found Not specified Not found
dbacp02640 Defensin coprisin MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Dung beetle Induces apoptosis and necrosis Radial diffusion assay, MIC assay SNU-484 Gastric cancer MIC : ≤ 50 μM
dbacp02641 Defensin coprisin MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Dung beetle Induces apoptosis and necrosis Radial diffusion assay, MIC assay SNU-601 Gastric cancer MIC : ≤ 50 μM
dbacp02642 Defensin coprisin MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Dung beetle Induces apoptosis and necrosis Radial diffusion assay, MIC assay SNU-638 Gastric cancer MIC : ≤ 50 μM
dbacp02643 Defensin coprisin MAKLIAFALVASLCLSMVLCNPLPEEVQEEGLVRQKRVTCDVLSFEAKGIAVNHSACALHCIALRKKGGSCQNGVCVCRN Dung beetle Induces apoptosis and necrosis Radial diffusion assay, MIC assay SNU-668 Gastric cancer MIC : ≤ 50 μM