1 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04626 | MBD-2 | CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM | Rat | Not specified | Not specified | Not found | Not found | Not found |
dbACP: A Comprehensive Database of Anti-Cancer Peptides
1 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04626 | MBD-2 | CHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYM | Rat | Not specified | Not specified | Not found | Not found | Not found |