dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04831 Neurotoxin BmK AGAP-SYPU2 VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG Manchurian scorpion Blocker of chloride channels and can inhibit the migration of glioma cells Antitumor activity assays S-180 Fibrosarcoma ED50 : 4.0 mg/kg