3 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp04593 | Mauriporin | MNKKTLLVIFFITMLIVDEVNSFKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAERRR | Fat-tailed scorpion | Induce cell apoptosis; Targets on the cell membranes and caused membrane lysis | MTT assay, Lactate dehydrogenase (LDH) Release assay | SACC-83 | Human salivary adenoid cystic carcinoma | IC50 : 27.9 μM - 283.3 μM |
| dbacp06599 | ZXR-1 | FKIGGFIKKLWRSKLA | Venom base | Inducing apoptosis | MTT assay | SACC-83 | Not found | IC50 : 27.9 ± 7.7 µM |
| dbacp08267 | ZXR-2 | FKIGGFIKKLWRSLLA | Synthetic | Not Available | MTT assay | SACC-83 | Salivary Cancer | IC50 = 9.9 ± 1.7 μM |