dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03289 HCAP18(109-135) FRKSKEKIGKEFKRIVQRIKDFLRNLV HCAP18 synthetic peptide Apoptosis inducing Not specified SAS-H1 Oral cancer Not found
dbacp03478 K4R2-Nal2-S1 Ac-KKKKRR-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp03484 K6-Nal2-S1 Ac-KKKKKK-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer MIC : 3.1 μM
dbacp04152 LL-37 [LL-37, 37 aa] Not found Inducing apoptosis Not specified SAS-H1 Not specified Not found
dbacp04825 Nal2-S1 Ac-KKWRKWLAKK-NH2 Not found Necrosis; Apoptosis MTT assay SAS Oral cancer MIC : 25 μM
dbacp06013 S1 (Ac-KKWRKWLAKK-NH2) Ac-NAl-NAl-KKWRKWLAKK-NH2 Not found Necrosis or apoptosis MTT assay SAS Oral cancer Not found