dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp03289 HCAP18(109-135) FRKSKEKIGKEFKRIVQRIKDFLRNLV HCAP18 synthetic peptide Apoptosis inducing Not specified SAS-H1 Oral cancer Not found
dbacp04152 LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Not found Inducing apoptosis Not specified SAS-H1 Not specified Not found