dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02338 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK Isolated from the giant silk moth, cecropia moth Membrane damage; Apoptotic cell death; Necrosis MTT/MTS assay SCC12 Skin cancer IC50 : 1 µM