dbACP: A Comprehensive Database of Anti-Cancer Peptides

16 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp05657 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay Raji Colorectal cancer IC50 : 6 μM
dbacp05658 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay Jurcat Colorectal cancer Not found
dbacp05659 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay K562 Colorectal cancer Not found
dbacp05660 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay U937 Colorectal cancer Not found
dbacp05661 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay A549 Colorectal cancer Not found
dbacp05662 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HT-29 Colorectal cancer Not found
dbacp05663 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay LoVo Colorectal cancer Not found
dbacp05664 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay U87 Colorectal cancer Not found
dbacp05665 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay MCF-7 Colorectal cancer Not found
dbacp05666 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay SKOV3 Colorectal cancer Not found
dbacp05667 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay PC-3 Colorectal cancer Not found
dbacp05668 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HepG2 Colorectal cancer Not found
dbacp05669 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay L02 Colorectal cancer Not found
dbacp05670 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HaCaT Colorectal cancer Not found
dbacp05671 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HEK293 Colorectal cancer Not found
dbacp05672 Protein GPR15LG (Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Protein GPR15 ligand) (Protein GPR15L) (Secreted protein C10orf99) MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV Human Cytotoxic effects SDS-PAGE assay HUVEC Colorectal cancer Not found