dbACP: A Comprehensive Database of Anti-Cancer Peptides

18 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01912 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay SKBR-3 Breast cancer Not found
dbacp02481 ChMAP-28 GRFKRFRKKLKRLWHKVGPFVGPILHY Domestic goat Cause cell membrane permeability; Induce necrotic death Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay SKBR-3 Human breast adenocarcinoma IC50 : 5.63 ± 1.05μM
dbacp04917 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 30% Cytotoxic at 5 µM
dbacp04918 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 50% Cytotoxic at 10 µM
dbacp04919 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70% Cytotoxic at 25 µM
dbacp04920 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04940 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 30% Cytotoxic at 5 µM
dbacp04941 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 50% Cytotoxic at 10 µM
dbacp04942 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70% Cytotoxic at 25 µM
dbacp04943 NRC-03 GRRKRKWLRRIGKGVKIIGGAALDHL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04962 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer ~0% Cytotoxic at 5 µM
dbacp04963 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 20% Cytotoxic at 10 µM
dbacp04964 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 70-80% Cytotoxic at 25 µM
dbacp04965 NRC-07 RWGKWFKKATHVGKHVGKAALTAYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 80-85% Cytotoxic at 50 µM
dbacp04984 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10% Cytotoxic at 5 µM
dbacp04985 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10% Cytotoxic at 10 µM
dbacp04986 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 10-15% Cytotoxic at 25 µM
dbacp04987 NRC-13 GWRTLLKKAEVKTVGKLALKHYL Skin mucous secretion of winter flounder Cell membrane damage MTT/MTS assay SKBR-3 Breast cancer 15-20% Cytotoxic at 50 µM