18 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01912 | BpirLAAO-I | ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY | Venom base | Inducing apoptosis | MTT assay | SKBR-3 | Breast cancer | Not found |
| dbacp02481 | ChMAP-28 | GRFKRFRKKLKRLWHKVGPFVGPILHY | Domestic goat | Cause cell membrane permeability; Induce necrotic death | Cytotoxic Activity assay, Lactate dehydrogenase (LDH)-Releaseassay, MTT assay | SKBR-3 | Human breast adenocarcinoma | IC50 : 5.63 ± 1.05μM |
| dbacp04917 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04918 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04919 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04920 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04940 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 30% Cytotoxic at 5 µM |
| dbacp04941 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 50% Cytotoxic at 10 µM |
| dbacp04942 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70% Cytotoxic at 25 µM |
| dbacp04943 | NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04962 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | ~0% Cytotoxic at 5 µM |
| dbacp04963 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 20% Cytotoxic at 10 µM |
| dbacp04964 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 70-80% Cytotoxic at 25 µM |
| dbacp04965 | NRC-07 | RWGKWFKKATHVGKHVGKAALTAYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 80-85% Cytotoxic at 50 µM |
| dbacp04984 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 5 µM |
| dbacp04985 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10% Cytotoxic at 10 µM |
| dbacp04986 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 10-15% Cytotoxic at 25 µM |
| dbacp04987 | NRC-13 | GWRTLLKKAEVKTVGKLALKHYL | Skin mucous secretion of winter flounder | Cell membrane damage | MTT/MTS assay | SKBR-3 | Breast cancer | 15-20% Cytotoxic at 50 µM |