dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01142 Amphipathic peptide CT1 MKTQFVILIVAVVLLQLISHSEAFLGALWNVAKSVFGKRGLRNFDDLDDTFEPEMSEADLKYLQDLLR Scorpions, Morelos, located in South-Central Mexico (Mexican scorpion) Not specified MTT/MTS assay MCF-7 Breast cancer IC50 : 6.3-12.5 μM
dbacp01143 Amphipathic peptide VmCT1 MKTQFVILIVAVVLLQLISHSEAFLGALWNVAKSVFGKRGLRNFDDLDDTFEPEMSEADLKYLQDLLR Scorpions, Morelos, located in South-Central Mexico (Mexican scorpion) Not specified Not specified Not found Not found Not found
dbacp06531 VmCT1 FLGALWNVAKSVF Scorpions, Morelos, located in South-Central Mexico Not specified Not specified Not found Not found Not found