dbACP: A Comprehensive Database of Anti-Cancer Peptides

3 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02724 Dermaseptin-PS1 ALWKTMLKKLGTVALHAGKAALGAVADTISQ Skin, the waxy monkey tree frog, South America Penetrating cell membrane Not specified Not found Not found Not found
dbacp02725 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay H157 Lung cancer IC50 : 15.67 μM
dbacp02726 Dermaseptin-PS3 ALWKDILKNAGKAALNEINQIVQ Skin, the waxy monkey tree frog, South America Membrane rupture MTT assay PC3 Human prostate carcinoma IC50 : 18.20 μM