dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp02917 Esculentin-2 HYba1 SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC Skin secretion, widespread fungoid frog, India, Asia Destroy cell membrane Not specified Not found Not specified Not found
dbacp02918 Esculentin-2 HYba2 SILSLFKMGAKALGKTLIKQAGKAGAEYVACKATNQC Skin secretion, widespread fungoid frog, India, Asia Destroy cell membrane Not specified Not found Not specified Not found