dbACP: A Comprehensive Database of Anti-Cancer Peptides

2 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06413 U1-TRTX-Ar1b SCVYERETCSKVRGPLCCRGECTCPIYGDCFCYGS-OHc Spider (Theraphosidae family) Membrane disruption Not specified Not found Not specified Not found
dbacp06414 U1-TRTXAgm3a ACGSFMWKCSERLPCCQEYVCSPQWKWCQNP-OHa Spider (Theraphosidae family) Membrane disruption Not specified Not found Not specified Not found