dbACP: A Comprehensive Database of Anti-Cancer Peptides

1 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp04697 Mouse beta-defensin-14 FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK Spleen, colon, and tissues of the upper and lower respiratory tract, Rat Not specified Not specified Not found Not found Not found