dbACP: A Comprehensive Database of Anti-Cancer Peptides

6 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01913 BpirLAAO-I ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY Venom base Inducing apoptosis MTT assay Jurkat Acute T cell Leukemia Not found
dbacp02565 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay Jurkat Acute T cell Leukemia IC50 : 20–34 uM
dbacp02566 CRAMP-18 E2K GKKLKKIGQKIKNFFQKL Synthetic Disrupt cell membrane structure MTT assay K-549 Acute T cell Leukemia IC50 : 20–34 uM
dbacp05264 Pep27 anal2 MWKWFHNVLSWWWLLADKRPARDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 23 µM
dbacp05269 Pep27 anal3 MRKWFHNVLSSGQLLADKWPAWDYNRK Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : 50 µM
dbacp05279 Pep27 anal5 MWKWFHNVLSSGQLLADKWWAWWYNWW Not found Inducing apoptosis MTT assay Jurkat T cell leukemia IC50 : > 70 µM