dbACP: A Comprehensive Database of Anti-Cancer Peptides

49 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp06705 P05 ADDGRPFPQVIK Aldolase A fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06707 P02 AEEYEFLTPMEEAPK Rho GDP Dissociation Inhibitor Alpha fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.93 at 50 μg/ml
dbacp06709 P01 SETAPAAPAAPAPAEK Histone H1.4 (H1-4) Fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.13 at 50 μg/ml
dbacp06711 P03 HVFGESDELIGQK Triosephosphate Isomerase (TPI) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.98 at 50 μg/ml
dbacp06713 P06 GAGTGGLGLAVEGPSEAK FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.17 at 50 μg/ml
dbacp06715 P07 VEPGLGADNSVVR FLNA (Filamin A) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 0.96 at 50 μg/ml
dbacp06717 P08 NSNLVGAAHEELQQSR Lamin A/C (LMNA) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.06 at 50 μg/ml
dbacp06719 P09 AAGTLYTYPENWR Eukaryotic Translation Elongation Factor 1 Gamma (Eef1G) fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.07 at 50 μg/ml
dbacp06721 P10 FAAATGATPIAGR 40S ribosomal protein fragment Apoptosis inducing MTT assay U-2 OS Bone Cancer Relative viability = 1.01 at 50 μg/ml
dbacp06747 M1-20 grrrqrrkkrlgpfsidllikslsdnmtdl Synthetic Inhibits FOXM1 transcriptional activities CCK-8 assay U-2 OS Bone Cancer IC50 = 25.65 µM
dbacp07124 DEE GLLDLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 61.00 ± 1.41 µM
dbacp07127 EEE GLLELLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 78.75 ± 5.30 µM
dbacp07130 HEE GLLHLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 47.50 ± 11 µM
dbacp07133 KEE GLLKLLELLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 49.38 ± 13.26 µM
dbacp07136 DHE GLLDLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 17.25 ± 1.06 µM
dbacp07139 EHE GLLELLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 18.25 ± 1.06 µM
dbacp07142 HHE GLLHLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 53.25 ± 5.30 µM
dbacp07145 KHE GLLKLLHLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 53 ± 2.83 µM
dbacp07148 DKE GLLDLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 9.93 ± 0.25 µM
dbacp07151 EKE GLLELLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 8.00 ± 0.71 µM
dbacp07154 HKE GLLHLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 15.95 ± 0.78 µM
dbacp07157 KKE GLLKLLKLLLEAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.75 ± 1.20 µM
dbacp07160 DEH GLLDLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 36.48 ± 3.92 µM
dbacp07163 EEH GLLELLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 19.60 ± 3.96 µM
dbacp07166 HEH GLLHLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 106 ± 14 µM
dbacp07169 KEH GLLKLLELLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 49.25 ± 5.30 µM
dbacp07172 DHH GLLDLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 55.85 ± 18.88 µM
dbacp07175 EHH GLLELLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 117 ± 7 µM
dbacp07178 HHH GLLHLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 185 ± 7 µM
dbacp07181 KHH GLLKLLHLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 39.75 ± 5.30 µM
dbacp07184 DKH GLLDLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 21.13 ± 3.01 µM
dbacp07187 EKH GLLELLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 23.83 ± 0.81 µM
dbacp07190 HKH GLLHLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 18.88 ± 1.24 µM
dbacp07193 KKH GLLKLLKLLLHAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 13.30 ± 0.99 µM
dbacp07196 DEK GLLDLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 19.88 ± 2.65 µM
dbacp07199 EEK GLLELLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 32.88 ± 4.07 µM
dbacp07202 HEK GLLHLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 143.20 ± 80.33 µM
dbacp07205 KEK GLLKLLELLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 8.15 ± 0.49 µM
dbacp07208 DHK GLLDLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 20.45 ± 2.05 µM
dbacp07211 EHK GLLELLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 25.00 ± 0 µM
dbacp07214 HHK GLLHLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.65 ± 1.91 µM
dbacp07217 KHK GLLKLLHLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.88 ± 1.24 µM
dbacp07220 DKK GLLDLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 10.40 ± 1.70 µM
dbacp07223 EKK GLLELLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.20 ± 1.84 µM
dbacp07226 HKK GLLHLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 12.23 ± 0.11 µM
dbacp07229 KKK GLLKLLKLLLKAAGW Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 9.65 ± 1.20 µM
dbacp07232 d-DHK GlldllhlllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 1.24 ± 0.03 µM
dbacp07235 d-DEK GlldllelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 5.84 ± 0.04 µM
dbacp07238 d-EEK GllellelllkaaGw Synthetic Selective membrane perforation prevents resistance. MTT assay U-2 OS Bone Cancer IC50 = 4.78 ± 0.02 µM