44 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01170 | Antimicrobial peptide TsAP-4 | MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY | Brazilian scorpion | Antiproliferative activity | Not specified | U251-MG | Prostate cancer | IC50 : 15.4 μM |
| dbacp02111 | cMastoparan-C(cMP-C) | CLNLKALLAVAKKILC | Synthetic construct | Apoptosis | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 8.56 μM |
| dbacp04576 | Mastoparan-C | LNLKALLAVAKKIL | European hornet | Apoptosis | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 1.4 μM |
| dbacp04581 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | MIC : 6.26 - 36.65 μM |
| dbacp04587 | Mastoparan-Cimals. XXA; UCLL1c) | LNLKALLAVAKKIL | Venom, the European Hornet | Inducing apoptosis | MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : < 4 μM |
| dbacp05808 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Lung cancer | IC50 : 104.10 µM |
| dbacp05809 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Prostate cancer | IC50 : 104.10 µM |
| dbacp05810 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Breast cancer | IC50 : 104.10 µM |
| dbacp05811 | R2PLx-22 | GIMDTVKNAAKNLAGQLLDKLK | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 104.10 µM |
| dbacp05889 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Lung cancer | IC50 : 16.14 µM |
| dbacp05890 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Prostate cancer | IC50 : 16.14 µM |
| dbacp05891 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Breast cancer | IC50 : 16.14 µM |
| dbacp05892 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05904 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCKITAC | Gram-negative purple non-sulfur bacteria | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 16.14 µm |
| dbacp05909 | Ranatuerin-2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Skin secretions, the pickerel frog, North America | Inducing apoptosis | MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay | U251-MG | Glioma | IC50 : 16.14 µM |
| dbacp05996 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Lung cancer | IC50 : 278.30 µM |
| dbacp05997 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Prostate cancer | IC50 : 278.30 µM |
| dbacp05998 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Breast cancer | IC50 : 278.30 µM |
| dbacp05999 | S−24-R2PLx | GIMDTVKNAAKNLAGQLLDKLKCSITAC | Not found | Inducing apoptosis | MTT and LDH assay | U251-MG | Glioma | IC50 : 278.30 µM |
| dbacp06186 | t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) | RKKRRQRRRLNLKALLAVAKKIL | Synthetic construct | Apoptosis inducing | MTT assay | U251-MG | Human glioblastoma astrocytoma | IC50 : 3.36 μM |
| dbacp06364 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom-derived cDNAlibrary of the Brazilian yellow scorpion | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 15.4 µM |
| dbacp06365 | TsAP-2 | FLGMIPGLIGGLISAFK | Venom, the Brazilian yellow scorpion, South America | Not specified | MTT/MTS assay | U251-MG | Human squamous carcinoma | IC50 : 15.4 µM |
| dbacp06372 | TsAP-S1 | FLSLIPKLVKKIIKAFK | Derivative of TsAP-1, Brazilian yellow scorpion venom peptide | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 2.9 µM |
| dbacp06373 | TsAP-S1 | FLSLIPKLVKKIIKAFK | The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design | Not specified | MTT/MTS assay | U251-MG | Human squamous carcinoma | IC50 : 0.83 - 2.0 µM |
| dbacp06380 | TsAP-S2 | FLGMIPKLIKKLIKAFK | Derivative of TsAP-1, Brazilian yellow scorpion venom peptide | Not specified | MTT/MTS assay | U251-MG | Brain tumor | IC50 : 2.0 µM |
| dbacp07050 | Temporin-PKE | FLPLIIGALSSLLPKIF | skin secretion of Pelophylax kl. esculentus | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 23.24 μM |
| dbacp07055 | Temporin-PKE-2K | FLPLIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.49 μM |
| dbacp07060 | Temporin-PKE-K12 | FLPLIIGALSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 25.75 μM |
| dbacp07065 | Temporin-PKE-3K | FLPKIIGKLSSLLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.83 μM |
| dbacp07070 | Temporin-PKE-4K | FLPKIIGKLSSKLPKIF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 85.52 μM |
| dbacp07075 | Temporin-PKE-i | FLPLIIGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 4.46 μM |
| dbacp07080 | Temporin-PKE-3i | FLPLiiGALSSLLPKiF | Synthetic | Charge-optimized membranolysis induces apoptosis. | MTT assay | U251-MG | Brain Tumor | IC50 = 120.6 μM |
| dbacp07262 | t-DPH1-K4 | GLWKKIKNVAAAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 32.18 μM |
| dbacp07266 | t-DPH1-5K | GLWKKIKNVAKAAGKAALGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 2.679 μM |
| dbacp07270 | t-DPH1-6K | GLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 593.7 μM |
| dbacp07274 | t-DPH1-6KW | WLWKKIKNVAKAAGKAAKGAL | Analogue of t-DPH1 | Membrane disruption induces apoptotic signaling. | MTT assay | U251-MG | Brain Tumor | IC50 = 1499 μM |
| dbacp07314 | B1OS-L | FLPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 8.629 µM |
| dbacp07319 | B1OS-D-L | FlPLIASLAGNVVPKIFCKITKRC | B-1OS | Not Available | MTT assay | U251-MG | Brain Tumor | IC50 = 3.492 µM |
| dbacp07408 | Dermaseptin-TO | ALWKDLLKNVGIAAGKAALNKVTDMVNQ | Phyllomedusa tomopterna | Membrane disruption induces cell death | MTT assay | U251-MG | Brain Tumor | Graph Figure-7 |
| dbacp07850 | Dermaseptin-PT9 | GLWSKIKDAAKTAGKAALGFVNEMV | Phyllomedusa tarsius | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 49.51 µM |
| dbacp07855 | K8, 23-DPT9 | GLWSKIKKAAKTAGKAALGFVNKMV | Synthetic | Membrane disruption and cationic enhancement | MTT assay | U251-MG | Brain Tumor | IC50 = 18.51 µM |
| dbacp08065 | Temporin-PE | FLPIVAKLLSGLL | Pelophylax kl. esculentus | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 25.13 μM |
| dbacp08069 | temporin-PEa | FLYIVAKLLSGLL | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.520 μM |
| dbacp08073 | temporin-PEb | FLPIVAKLLSGLLGRKKRRQRRR | Synthetic analog of Temporin-PE | Modulates membrane interactions | MTT assay | U251-MG | Brain Tumor | IC50 = 3.087 μM |