dbACP: A Comprehensive Database of Anti-Cancer Peptides

44 result(s) have been found!

Accession Name Sequence Source/Organism Mechanism Assay Type Cell Line Cancer Type Activity
dbacp01170 Antimicrobial peptide TsAP-4 MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY Brazilian scorpion Antiproliferative activity Not specified U251-MG Prostate cancer IC50 : 15.4 μM
dbacp02111 cMastoparan-C(cMP-C) CLNLKALLAVAKKILC Synthetic construct Apoptosis MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 8.56 μM
dbacp04576 Mastoparan-C LNLKALLAVAKKIL European hornet Apoptosis MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 1.4 μM
dbacp04581 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma MIC : 6.26 - 36.65 μM
dbacp04587 Mastoparan-Cimals. XXA; UCLL1c) LNLKALLAVAKKIL Venom, the European Hornet Inducing apoptosis MTT cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : < 4 μM
dbacp05808 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay U251-MG Lung cancer IC50 : 104.10 µM
dbacp05809 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay U251-MG Prostate cancer IC50 : 104.10 µM
dbacp05810 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay U251-MG Breast cancer IC50 : 104.10 µM
dbacp05811 R2PLx-22 GIMDTVKNAAKNLAGQLLDKLK Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 104.10 µM
dbacp05889 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Lung cancer IC50 : 16.14 µM
dbacp05890 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Prostate cancer IC50 : 16.14 µM
dbacp05891 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Breast cancer IC50 : 16.14 µM
dbacp05892 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 16.14 µM
dbacp05904 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCKITAC Gram-negative purple non-sulfur bacteria Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Human glioblastoma astrocytoma IC50 : 16.14 µm
dbacp05909 Ranatuerin-2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Skin secretions, the pickerel frog, North America Inducing apoptosis MTT Cell viability assay and Lactate dehydrogenase (LDH) leakage assay U251-MG Glioma IC50 : 16.14 µM
dbacp05996 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Lung cancer IC50 : 278.30 µM
dbacp05997 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Prostate cancer IC50 : 278.30 µM
dbacp05998 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Breast cancer IC50 : 278.30 µM
dbacp05999 S−24-R2PLx GIMDTVKNAAKNLAGQLLDKLKCSITAC Not found Inducing apoptosis MTT and LDH assay U251-MG Glioma IC50 : 278.30 µM
dbacp06186 t Mastoparan-C(tMP-C, Tat (49-57)-Mastoparan-C) RKKRRQRRRLNLKALLAVAKKIL Synthetic construct Apoptosis inducing MTT assay U251-MG Human glioblastoma astrocytoma IC50 : 3.36 μM
dbacp06364 TsAP-2 FLGMIPGLIGGLISAFK Venom-derived cDNAlibrary of the Brazilian yellow scorpion Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 15.4 µM
dbacp06365 TsAP-2 FLGMIPGLIGGLISAFK Venom, the Brazilian yellow scorpion, South America Not specified MTT/MTS assay U251-MG Human squamous carcinoma IC50 : 15.4 µM
dbacp06372 TsAP-S1 FLSLIPKLVKKIIKAFK Derivative of TsAP-1, Brazilian yellow scorpion venom peptide Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 2.9 µM
dbacp06373 TsAP-S1 FLSLIPKLVKKIIKAFK The iNot foundctive natural peptide TsAP-1 was made active by increasing 4 lysines and one leucine, template-based design Not specified MTT/MTS assay U251-MG Human squamous carcinoma IC50 : 0.83 - 2.0 µM
dbacp06380 TsAP-S2 FLGMIPKLIKKLIKAFK Derivative of TsAP-1, Brazilian yellow scorpion venom peptide Not specified MTT/MTS assay U251-MG Brain tumor IC50 : 2.0 µM
dbacp07050 Temporin-PKE FLPLIIGALSSLLPKIF skin secretion of Pelophylax kl. esculentus Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 23.24 μM
dbacp07055 Temporin-PKE-2K FLPLIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.49 μM
dbacp07060 Temporin-PKE-K12 FLPLIIGALSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 25.75 μM
dbacp07065 Temporin-PKE-3K FLPKIIGKLSSLLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 2.83 μM
dbacp07070 Temporin-PKE-4K FLPKIIGKLSSKLPKIF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 85.52 μM
dbacp07075 Temporin-PKE-i FLPLIIGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 4.46 μM
dbacp07080 Temporin-PKE-3i FLPLiiGALSSLLPKiF Synthetic Charge-optimized membranolysis induces apoptosis. MTT assay U251-MG Brain Tumor IC50 = 120.6 μM
dbacp07262 t-DPH1-K4 GLWKKIKNVAAAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 32.18 μM
dbacp07266 t-DPH1-5K GLWKKIKNVAKAAGKAALGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 2.679 μM
dbacp07270 t-DPH1-6K GLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 593.7 μM
dbacp07274 t-DPH1-6KW WLWKKIKNVAKAAGKAAKGAL Analogue of t-DPH1 Membrane disruption induces apoptotic signaling. MTT assay U251-MG Brain Tumor IC50 = 1499 μM
dbacp07314 B1OS-L FLPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 8.629 µM
dbacp07319 B1OS-D-L FlPLIASLAGNVVPKIFCKITKRC B-1OS Not Available MTT assay U251-MG Brain Tumor IC50 = 3.492 µM
dbacp07408 Dermaseptin-TO ALWKDLLKNVGIAAGKAALNKVTDMVNQ Phyllomedusa tomopterna Membrane disruption induces cell death MTT assay U251-MG Brain Tumor Graph Figure-7
dbacp07850 Dermaseptin-PT9 GLWSKIKDAAKTAGKAALGFVNEMV Phyllomedusa tarsius Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 49.51 µM
dbacp07855 K8, 23-DPT9 GLWSKIKKAAKTAGKAALGFVNKMV Synthetic Membrane disruption and cationic enhancement MTT assay U251-MG Brain Tumor IC50 = 18.51 µM
dbacp08065 Temporin-PE FLPIVAKLLSGLL Pelophylax kl. esculentus Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 25.13 μM
dbacp08069 temporin-PEa FLYIVAKLLSGLL Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.520 μM
dbacp08073 temporin-PEb FLPIVAKLLSGLLGRKKRRQRRR Synthetic analog of Temporin-PE Modulates membrane interactions MTT assay U251-MG Brain Tumor IC50 = 3.087 μM