4 result(s) have been found!
| Accession | Name | Sequence | Source/Organism | Mechanism | Assay Type | Cell Line | Cancer Type | Activity |
|---|---|---|---|---|---|---|---|---|
| dbacp01149 | Ant-Bad | RQIKIWFQNRRMKWKKNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : 40.2 µM |
| dbacp01152 | Ant-Bak | RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : > 100 µM |
| dbacp01155 | Ant-Bax | RQIKIWFQNRRMKWKKSTKKLSECLKRIGDELDSnM | Effectors (BAK, BAX) | Apoptosis inducing | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | IC50 : > 100 µM |
| dbacp05824 | R8-BAD | RRRRRRRRGCNLWAAQRYGRELRRMSDEFVD | BH3-only, Sensizers (BAD, HRK, Noxa) | Inducing apoptosis | Not specified | UM-22B | Head and neck squamous cell carcinomas (HNSCC) | Not found |